Filter Results
31906 results
The dataset contains the CAD of the Duse Theatre of Bologna in two configurations of the stage. Configuration A is intended for prose and opera. Configuration B is optimised for a large symphonic orchestra using a canopy array and removing wings and curtains. Measured IRs are available too.
Data Types:
  • Other
  • Tabular Data
  • Dataset
  • Audio
Data collection form & AACAP poster presentation
Data Types:
  • Slides
  • Dataset
  • Document
To identify the phosphorylation sites of Npas4, GST-Npas4-390-489 aa, GST-Npas4 490-597 aa or GST-Npas4 598-701 aa was expressed in COS7 cells with or without the coexpression of MAP2K1-CA. Cells were lysed in lysis buffer [20 mM Tris/HCl, 1 mM EDTA, 150 mM NaCl, 1% NP-40, protease inhibitor cocktail (Roche), and phosphatase inhibitor cocktail (PhosStop, Roche), pH 7.5], and sonicated 3 times for 5 sec. After centrifugation at 16,000×g at 4°C for 10 min, the soluble supernatant was incubated in 30 µl of glutathione-Sepharose 4B beads (GE Healthcare) for 1 hr at 4°C with rotation. The beads were then washed three times with lysis buffer and an additional three times with wash buffer (20 mM Tris/HCl, 1 mM EDTA, and 150 mM NaCl, pH 7.5). The bound proteins were extracted from the beads using urea solution, reduced via incubation in 5 mM dithiothreitol for 30 min, and alkylated using 10 mM iodoacetamide for 1 h in the dark. The proteins were digested with Trypsin/Lys-C (Promega) or Glu-C (Promega)/Asp-N (FUJIFILM Wako). Demineralization was performed using SPE c-tips according to the manufacturer’s instructions. The peptides were analyzed by LC−MS using an Orbitrap Fusion mass spectrometer (Thermo Fisher Scientific Inc). Dual-phosphorylated peptide DLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQE, containing T423 and T427 phosphorylation sites, was identified from digested fragments of GST-Npas4-390-489 aa; LPPSPSSPGNGDCTLLALAQLR, containing S577 and S580 phosphorylation sites, was identified from digested fragments of GST-Npas4 490-597 aa; and GLLTPEASPVKQSFFHYTEKE, containing T611 and S615 phosphorylation sites, was identified from digested fragments of GST-Npas4 598-701 aa. Selected ion monitoring (SIM) analysis revealed that the amount of these dual-phosphorylation was significantly increased by coexpression with MAP2K1-CA. These results suggest that Npas4 is phosphorylated by MAPK at T423, T427, S577, S580, T611 and S615 sites.
Data Types:
  • Slides
  • Software/Code
  • Tabular Data
  • Dataset
Flaviviruses, such as Dengue (DENV), Zika, Yellow Fever, Japanese Encephalitis and West Nile are important pathogens with high morbidity and mortality. The last estimation indicates that ~390 millions of people are infected by DENV per year. The DENV life cycle occur mainly in the cytoplasm of the infected cells and different cytoplasmic, nuclear and mitochondrial proteins participate in viral replication. In this paper we analyzed the participation of Aurora kinase B (AurKB) in the DENV replicative cycle using the specific AurKB inhibitor ZM447439. The kinase inhibition does not alter the viral protein production/secretion or genome replication but impaired the viral yield without altering the percentage of infected cells. Moreover, confocal microscopy analysis of DENV-infected ZM447439-treated cells show a delocalization of viral components from the replicative complexes. In summary, these observations indicate that AurKB participate in DENV viral morphogenesis or release.
Data Types:
  • Slides
  • Dataset
  • Document
This file includes the raw data for Western blot for Figure 1J and 6I in the manuscript "Dengue NS2A protein orchestrates virus assembly". The raw and cropped images are shown.
Data Types:
  • Slides
  • Dataset
The data here includes necessary information for the MWR-assisted surface engineering project we worked on.
Data Types:
  • Other
  • Slides
  • Software/Code
  • Image
  • Tabular Data
  • Dataset
  • Text
Data for a strawberry mitogen-activated protein kinase gene, FaMAPK19, is involved in disease resistance against Botrytis cinerea
Data Types:
  • Slides
  • Tabular Data
  • Dataset
The data includes the EBSD characterizations of cold rolled samples, Permeation curves from the hydrogen permeation experiment and the EDS charcterizations after the Microprint experiment
Data Types:
  • Slides
  • Dataset
  • Document
  • Text
Objective: to produce a mental health podcast with young people from urban poverty contexts , based on their priority, on the processes of individual and social dimensions regarding suicidal behavior. Method: project approved by the applicant institution. Qualitative research developed through action research. The theoretical reference of choice is intersectionality, which reflects the multiplicities of differentiations that, articulating with gender, permeate the social. This approach does not emphasize the determinations of phenomena only on the economic basis, but also from other social markers, since several inequality aspects are now recognized as influencing the subjects' daily practices. The unit selected will be the State School, which belongs to the East Education Board 2, located in the Itaim Paulista neighborhood, east side of São Paulo (SP) - Brazil. Data collection will be performed through workshops - group technique that allows data collection in participatory research. All workshops will be recorded and filmed for further analysis. The instruments and methods of data collection will occur through interviews, field journal and different participatory strategies during the development of the workshops. The interviews will take place according to the questionnaire that apprehends the Social Reproduction Index (SRI), which analyzes the different dimensions of the social life of the groups. It is a tool capable of apprehending the differences of social reproduction that characterize the social classes that are part of a given territory, being able to show the different epidemiological profiles of families, even if they are living in the same micro space. This differentiation enables the planning of educational or other actions. The field journal used to make a dense description of what was observed in the field, written and/or recorded immediately to the field activity. Data processing: the workshops will be transcribed and inserted in the QSRNvivo software, used for text analysis and other materials, such as videos and audios. It is a useful technological tool for qualitative research to organize and analyze data production, which facilitates analysis, since the software is unable to understand the results. Analysis: will be followed a multilevel analysis, which considers the identity construction of the subjects, the symbolic representations and the social structure in which the participants are immersed.
Data Types:
  • Other
  • Dataset
  • Document
  • Text
  • Audio
Research data
Data Types:
  • Slides
  • Dataset
8